PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g10370.2.p
Common NameBRADI_5g10370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family HB-other
Protein Properties Length: 182aa    MW: 20156.9 Da    PI: 10.3807
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g10370.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.5e-184495657
                      S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      +++++q+ +Le++F++++ p+++  ++L+ klg+  +qVk+WFqNrR  +kk
  Bradi5g10370.2.p 44 RHSRDQVAQLEAVFQQCPRPDEQVQQDLSVKLGMGANQVKFWFQNRRSAKKK 95
                      6799*******************************************88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-172499IPR009057Homeodomain-like
SuperFamilySSF466891.24E-162898IPR009057Homeodomain-like
PROSITE profilePS5007114.7383696IPR001356Homeobox domain
SMARTSM003891.2E-1539100IPR001356Homeobox domain
CDDcd000861.74E-134090No hitNo description
PfamPF000463.6E-154495IPR001356Homeobox domain
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MDGLAFDPNT NVGNTDGVDA VAAGKDNNVG ATDSQRTATK RFKRHSRDQV AQLEAVFQQC  60
PRPDEQVQQD LSVKLGMGAN QVKFWFQNRR SAKKKKQKQE EVKLLREESW RLHVENQTIK  120
TALFKKTCLK CGVPMVHVVG DTPEKRRLLA ENAKLKNDLL HANAFLNMIS GGSEGAPSSR  180
A*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18894RRSAKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227138.11e-133PREDICTED: homeobox-leucine zipper protein ROC5-like
TrEMBLI1IXU71e-132I1IXU7_BRADI; Uncharacterized protein
STRINGBRADI5G10370.11e-132(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16772512
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.27e-23HD-ZIP family protein